Наследование групп крови резус

  • Просмотров 104
  • Скачиваний 12
  • Размер файла 108
    Кб

Наследование групп крови резус На рисунке представлено положение резус белка резус в мембране эритроцитов. Почему он так назван? В 30-40-х годах, когда довольно интенсивно проводились исследования групп крови, было обнаружено, что антитела к группе крови мартышки резус агглютинируют у некоторых людей их эритроциты. Агглютинация – это процесс склеивания эритроцитов под действием антител к белам, расположенным на мембранах

эритроцитов. На рисунке ниже представлен картина агглютинации. Здесь изображены капельки крови , к которым добавлена сыворотка, содержащая антитела к резус-белку. Синим обведены капли, в которых с кровью ничего не происходит. Если реакция при добавлении антител не идет, то, значит у данного человека резус-белок отсутствует. Красным обведены образцы крови, в которых происходит агглютинация. Буквами помечены капли крови, которые

реакцию дают, но очень слабую. Такое встречается у приблизительно 1% людей, и это так и называемый слабый резус фенотип. С чем это связано? На рисунке ниже буквами представлена последовательность резус-белка. Вы знаете, что белок состоит из 20 аминокислот, каждая из которых обозначается своей буквой. Ген (последовательность нуклеотидов, соответственно, в 3 раза более длинная последовательность, записанная только четыремя буквами,

а не 20), который кодирует резус-белок, называется RHD. АМИНОКИСЛОТНАЯ ПОСЛЕДОВАТЕЛЬНОСТЬ РЕЗУС-БЕЛКА ЧЕЛОВЕКА (каждая аминокислота обозначена одной буквой): Информация из базы данных NCBI Human RhD blood group antigen mRNA, complete cds ORGANISM Homo sapiens standard_name="RhD" MSSKYPRSVRRCLPLWALTLEAALILLFYFFTHYDASLEDQKGLVASYQV GQDLTVMAAIGLGFLTSSFRRHSWSSVAFNLFMLALGVQWAILLDGFLSQ FP SGKVVITLFSIRLATMSALSVLISVDAVLGKVNLAQLVVMVLVEVTA LGNLRMVISNIFNTDYHMNMMHIYVFAAYFGLSVAWCLPKPLPEGTEDKD QTATIPSLSAMLGALFLWMFWPSFNSALLRSPIERKNAVFNTYYAVAVSV VTAISGSSLAHPQGKISKTYVHSAVLAGGVAVGTSCHLIPSPWLAMVLGL

VAGLISVGGAKYLPGCCNRVLGIPHSSIMGYNFSLLGLLGEIIYIVLLVL DTVGAGNGMIGFQVLLSIGELSLAIVIALTSGLLTGLLLNLKIWKAPHEA KYFDDQVFWKFPHLAVGF ПОСЛЕДОВАТЕЛЬНОСТЬ НУКЛЕОТИДОВ КОДИРУЮЩЕЙ ЧАСТИ ГЕНА РЕЗУС-БЕЛКА ЧЕЛОВЕКА Информация из базы данных NCBI 1 atgagctcta agtacccgcg gtctgtccgg cgctgcctgc ccctctgggc cctaacactg 61 gaagcagctc tcattctcct cttctatttt tttacccact atgacgcttc cttagaggat 121 caaaaggggc tcgtggcatc ctatcaagtt ggccaagatc tgaccgtgat ggcggccatt 181 ggcttgggct tcctcacctc gagtttccgg agacacagct ggagcagtgt ggccttcaac 241 ctcttcatgc tggcgcttgg tgtgcagtgg gcaatcctgc tggacggctt cctgagccag 301 ttcccttctg ggaaggtggt catcacactg ttcagtattc ggctggccac catgagtgct 361 ttgtcggtgc tgatctcagt ggatgctgtc ttggggaagg tcaacttggc